"action" : "rerender" } { "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", ] { ] "event" : "addMessageUserEmailSubscription", { } "actions" : [ "event" : "ProductAnswer", { } console.log(LITHIUM) "action" : "pulsate" "kudosable" : "true", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2812991 .lia-rating-control-passive', '#form_8'); "initiatorBinding" : true, "initiatorBinding" : true, console.log(LITHIUM) "actions" : [ "action" : "rerender" }, ] }, "context" : "envParam:quiltName", }, "parameters" : { ] }, "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { } }, } border-top-left-radius: 4px; var handleOpen = function(event) { { "context" : "envParam:quiltName,product,contextId,contextUrl", { LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); { { "event" : "kudoEntity", } "actions" : [ watching = false; "action" : "rerender" } .teaser__list li::before { "actions" : [ } } "use strict"; ] { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, "useSubjectIcons" : "true", // Your code here... "disableLinks" : "false", "actions" : [ LITHIUM.Dialog.options['634763771'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_8", "context" : "envParam:selectedMessage", ] "context" : "", } "context" : "envParam:selectedMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } }); "action" : "pulsate" "selector" : "#kudosButtonV2_0", { { "kudosLinksDisabled" : "false", { "context" : "envParam:quiltName", } LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); ], ] Wie genau die Funktions-Diagnose funktioniert, erfahren Sie in unserer Schritt-für-Schritt-Anleitung und der Kurzanleitung. "context" : "envParam:quiltName,product,contextId,contextUrl", ] if (isNaN(val) ) "kudosable" : "true", Damit Sie mit der Fritzbox wieder auf das Internet zugreifen können, ist es wichtig, die Ursache . LITHIUM.Dialog({ }, { "event" : "removeThreadUserEmailSubscription", LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { }, { watching = true; "context" : "envParam:quiltName", "componentId" : "forums.widget.message-view", "disableKudosForAnonUser" : "false", { "actions" : [ { Bist du sicher, dass du fortfahren möchtest? "actions" : [ "event" : "MessagesWidgetEditAction", ] "action" : "rerender" }, { Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetCommentForm", { { "actions" : [ "context" : "lia-deleted-state", "useTruncatedSubject" : "true", "action" : "rerender" "context" : "", "actions" : [ { "event" : "deleteMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2812976 .lia-rating-control-passive', '#form_4'); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "actions" : [ "context" : "", "context" : "", "componentId" : "forums.widget.message-view", { }, Die DSL-Verbindung zwischen der FRITZ!Box und der Vermittlungsstelle des DSL-Anbieters bricht mehrmals täglich ab. "eventActions" : [ "actions" : [ "event" : "MessagesWidgetEditAction", } } }, { }, { { "context" : "", "action" : "rerender" "action" : "rerender" { { ] LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); { return { } "message" : "2812987", ] //var height = $(window).scrollTop(); { }, } "event" : "approveMessage", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "kudosLinksDisabled" : "false", ], "actions" : [ }, "action" : "rerender" "disableLabelLinks" : "false", { "actions" : [ "use strict"; "context" : "", ;(function($) { ] // console.log(key); "actions" : [ "event" : "ProductAnswer", "revokeMode" : "true", }, "actions" : [ "event" : "expandMessage", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "context" : "envParam:quiltName,message", { }, Wenn Sie die Diagnose der Fritzbox nicht öffnen oder nutzen können oder partout keine Lösung für ein Problem finden, nutzen Sie die folgenden Tipps, um Ihre WLAN-Verbindung zu verbessern und Fehler zu lokalisieren: Deine Datensicherheit bei der Nutzung der Teilen-Funktion, Um diesen Artikel oder andere Inhalte über Soziale-Netzwerke zu teilen, brauchen wir deine Zustimmung für, Funktions-Diagnose über die Fritzbox starten, Checkliste bei WLAN-Problemen mit der Fritzbox, Großes Update auf Fritz!OS 7.50 bringt über 100 Neuerungen auf die Fritzbox, Mit wenigen Handgriffen die WLAN-Reichweite erhöhen, | Weitere Online-Angebote von Axel Springer. document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "actions" : [ "context" : "envParam:quiltName", ] "action" : "rerender" } $('#custom-overall-notif-count').html(notifCount); "actions" : [ } "action" : "rerender" "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "buttonDialogCloseAlt" : "Schließen", { } "action" : "rerender" }, ✔ So lösen Sie das Problem. document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "selector" : "#messageview_6", "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] }, "action" : "rerender" } "event" : "markAsSpamWithoutRedirect", }, "context" : "", "initiatorBinding" : true, { "context" : "envParam:quiltName,message", "parameters" : { "event" : "ProductAnswer", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "editProductMessage", }, { "actions" : [ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Ihre Fritzbox meldet immer noch ein Problem? "action" : "rerender" { LITHIUM.Dialog.options['634763771'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ }, .teaser__2col { }, if ( count == neededkeys.length ) { "actions" : [ o.innerHTML = "Page number must be 1 or greater. "actions" : [ } width: 12px; })(LITHIUM.jQuery); "action" : "rerender" "event" : "removeThreadUserEmailSubscription",
Häufige Abbrüche der WLAN-Verbindung | FRITZ!Repeater 2400 }, const pageName = LITHIUM.Components.ORIGINAL_PAGE_NAME; } function clearWarning(pagerId) { "context" : "envParam:selectedMessage", } { "message" : "2811572", }, return true; "event" : "MessagesWidgetMessageEdit", }, { { }, "actions" : [ }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "selector" : "#kudosButtonV2_5", })(); } "event" : "ProductMessageEdit", }, } "componentId" : "forums.widget.message-view", }, // Reset the conditions so that someone can do it all again. "action" : "rerender" "context" : "", "eventActions" : [ LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, $('li.close-on-click').on('click',resetMenu); // Oops, not the right sequence, lets restart from the top. ] "context" : "envParam:quiltName,product,contextId,contextUrl", }, }, } "context" : "envParam:quiltName,message", { "quiltName" : "ForumMessage", "revokeMode" : "true", { } Anschließend können Sie das Fritzbox-Netzteil wieder einstecken. ] ] { "event" : "addMessageUserEmailSubscription", } "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "accessibility" : false, "useTruncatedSubject" : "true", "entity" : "2812987", var key = e.keyCode; "event" : "MessagesWidgetMessageEdit", { "useSimpleView" : "false", } "context" : "", "kudosable" : "true", "action" : "rerender" ] "action" : "rerender" "displayStyle" : "horizontal", { "event" : "markAsSpamWithoutRedirect", "context" : "", "actions" : [ ] { }, document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "eventActions" : [ "context" : "", "useTruncatedSubject" : "true", "action" : "pulsate" ] element.removeClass('active'); "actions" : [ "kudosable" : "true", { Nutzer erhalten so Hinweise darauf, ob sie ihre Fritzbox umstellen müssen und können die neue Position im Anschluss ebenfalls gleich testen. }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { "event" : "MessagesWidgetEditCommentForm", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } count = 0; }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2812957,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "removeThreadUserEmailSubscription", if ( neededkeys[count] == key ) { "displaySubject" : "true" } "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'BtkuYi1fQfw6TF5CpQrSuV0iI7L0juLDbvsGF6Vfftg. watching = false; { { } "action" : "rerender" } { }, ] "context" : "envParam:quiltName,message", }, let markup = ` "event" : "MessagesWidgetEditCommentForm", LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); Ich kenne mich selbst schon ein klein wenig mit dem Thema hier aus und leider reicht mein Wissen nicht aus um das Problem zu begreifen. } "context" : "", "action" : "rerender" "event" : "ProductAnswerComment", ] "context" : "", } "event" : "unapproveMessage", ] { "actions" : [ "action" : "rerender" Klicken Sie zum Speichern der Einstellungen auf "Übernehmen". } // Oops. "actions" : [ ] "action" : "pulsate" ] } "parameters" : { "displayStyle" : "horizontal", var element = $(this).parent('li'); "event" : "addThreadUserEmailSubscription",
Ständig Verbindungsabbrüche 1&1 DSL FritzBox 7362 Sl
Sperrung Regattastraße,
Radioaktiver Zerfall Aufgaben Mit Lösungen,
تجاربكم مع انفصال المشيمة في الشهر الثامن,
Articles F